PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004826m
Common NameEUTSA_v10004826mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 27985.2 Da    PI: 9.7456
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004826mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.81.4e-281058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     +ienk++rqvtfskRr+g+ KKA+E+SvLCda+va+i+fs++gkl+eys
  Thhalv10004826m 10 QIENKIRRQVTFSKRRTGLVKKAQEISVLCDADVALIVFSPKGKLFEYS 58
                     69**********************************************8 PP

2K-box851.6e-28891731599
            K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       ++++e +kL + i+ +qr++Rhl+Ge+++sLs++eL+ Le qL++slk+ Rs+Kn+l++e+i +lqkkekel+e  k+L kk++
  Thhalv10004826m  89 GECSTECSKLLRMIDVMQRSLRHLKGEEVDSLSIRELHALEMQLDTSLKRTRSRKNQLMVESIAQLQKKEKELKELRKQLAKKID 173
                      57899******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.067161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-31280IPR002100Transcription factor, MADS-box
CDDcd002653.64E-37279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-273859IPR002100Transcription factor, MADS-box
PfamPF014865.4E-2487172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.28888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVQLRQ IENKIRRQVT FSKRRTGLVK KAQEISVLCD ADVALIVFSP KGKLFEYSAG  60
SSMERILDRY ERCSYAGQDI PTPSLDSQGE CSTECSKLLR MIDVMQRSLR HLKGEEVDSL  120
SIRELHALEM QLDTSLKRTR SRKNQLMVES IAQLQKKEKE LKELRKQLAK KIDQREDSEP  180
QNLSQGLASL AIPPCEPPHP LPRPTSPPPP LSLGGTSHRN EVGDLDAGTL IRPTNTTLPH  240
WMPRLTGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-18170169Myocyte-specific enhancer factor 2B
1tqe_R3e-18170169Myocyte-specific enhancer factor 2B
1tqe_Q3e-18170169Myocyte-specific enhancer factor 2B
1tqe_P3e-18170169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395258.10.0hypothetical protein EUTSA_v10004826mg
SwissprotQ9SBK91e-69CAL_BRARP; Transcription factor CAULIFLOWER
TrEMBLV4KMQ10.0V4KMQ1_EUTSA; Uncharacterized protein
STRINGBra036201.1-P1e-136(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM130331525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.11e-116AGAMOUS-like 79